DNA is made of 2 stands. The two strands have to be complementary. For virtually all genes, only one stand codes for a functional protein. This stand is transcribed (copied) as mRNA, which is translated into an amino acid sequence that constitutes a protein. The other strand is not usable typically, produce short junk sequences, or may not even have an appropriate starting or stopping signal/position. The pfizer vaccine contains mRNA, which is single-stranded. It codes for the spike protein. There was a major discovery this year that sometimes mRNA can be written into DNA, via a lesser known human polymerase and also co-infecting viral polymerase. Also evidence that when infected some genetic material is integrated. If the pfizer mRNA was written into DNA, it just so happens that it's complementary strand WOULD code for a long, sizable protein. This protein is not very similar to anything know with unknown biological effects (if any).
But there are only 1.5% coding genes for those proteins, whereas 98.5% of the whole genome is a kind of quorum that bio-logically ''decides'' what protein to make, depending on co-evolutionary context. And mRNA-''vaccines'' are completely bypassing said quorum and insert a bio-illogical blueprint into the ''heart'' of the coding genes. It is like a minority of politicians bypassing the majority of a population in order zu ''synthesize'' new orders ...
I wonder if there are more protein codes unknown to science to be discovered from their vaxes? I read that moderna even hidden the ingredients of the vaccine from its production employees.
The bioweapon works exactly as intended. Vax is the weapon Humanity is The Virus they intend to kill, damage for life, sterilise, so useless eaters don't reproduce. They've told us the truth years in advance, but nobody is paying attention to "Bunch of nonsense and "conspiracy theories" 2012/1992 -https://lionessofjudah.substack.com/p/the-corona-end-game-addendum
I have no idea what this means so I started to search around and found this right away:
“Finally, we also show that segments of the C-terminal tail of pandonodin can be replaced with arbitrary sequences, allowing for the construction of pandonodin–protein fusions.”
Not sure I understand anything any better though, but seems to follow what I am getting out of the last part of this post - which is the possible use of this thing for the introduction of something else. Maybe. Or maybe not.
How dare you ... don't you know that getting vaxxed and infected afterwards gives you ''super-immunity''? Forget the truth. Now you can even have ''super-truth'':
"It’s time to reject the ‘science’ of the ‘scientists’ who’ve lied to us for nearly two years. That’s our Christmas gift to ourselves. Our only resolution for 2022 should be to demand - and be given - the truth."
Whatever it takes, let 2022 become the "Year of THE truth".
There are two immunogenic epitopes predicted by SVMTrip, and they map to, among other things, a key heart calcium channel proteins. It's a stretch (speculative analysis, Rev transcription, predicted epitopes) but certainly worth cataloging. Thank you for the prompt!
Wow, good eye. Don't children have high levels of reverse transcriptase? I though I read or heard somewhere recently that they do because their developing so rapidly. Please let me know if you're aware of anything on this. Thanks, Dawn.
Wow, you caught that! Awesome. Question. . . Don't Children have high levels of reverse transcriptase because they are developing so fast ? I thought I heard or read that somewhere recently. If so, could there be any implication with this discovery if their Pfizer vaxxed? If anyone know anything please let me know. I'm curious.
I have been following you for years as the aunt of a vaccine injured child (now man). Just want to say how much I appreciate your tenacity in shining a light on the dangers forced upon us by pharma and our complicit government. I don’t pretend to understand all of this, but I keep trying and trust you to get to the core of the issue.
Is there a cliff notes version that summarizes the import?
Yes. The "vaccine" is, in fact, not safe and effective.
(But I agree, would love a cliff notes version!)
DNA is made of 2 stands. The two strands have to be complementary. For virtually all genes, only one stand codes for a functional protein. This stand is transcribed (copied) as mRNA, which is translated into an amino acid sequence that constitutes a protein. The other strand is not usable typically, produce short junk sequences, or may not even have an appropriate starting or stopping signal/position. The pfizer vaccine contains mRNA, which is single-stranded. It codes for the spike protein. There was a major discovery this year that sometimes mRNA can be written into DNA, via a lesser known human polymerase and also co-infecting viral polymerase. Also evidence that when infected some genetic material is integrated. If the pfizer mRNA was written into DNA, it just so happens that it's complementary strand WOULD code for a long, sizable protein. This protein is not very similar to anything know with unknown biological effects (if any).
Thank you!!
But there are only 1.5% coding genes for those proteins, whereas 98.5% of the whole genome is a kind of quorum that bio-logically ''decides'' what protein to make, depending on co-evolutionary context. And mRNA-''vaccines'' are completely bypassing said quorum and insert a bio-illogical blueprint into the ''heart'' of the coding genes. It is like a minority of politicians bypassing the majority of a population in order zu ''synthesize'' new orders ...
You mean it's like the CDC dictating a policy that goes against the advice of its own expert advisory panel?
Yeah, like one would-be ''expert'' against a diversity of experts.
It pays to have remembered our high school education on the DNA structure that included Adenine, Guanine, Cytosine, and Thymine.
Much of this is hard to wade through but the words and concepts are easy to recognize...if you paid attention in science and biology classes.
I believe that you and I had very different high school educations. I'm beginning to think either I wasn't paying attention or my teachers weren't.
Like listening to the Sgt. Pepper album backwards!
Like that analogy
Good analogy!
I wonder if there are more protein codes unknown to science to be discovered from their vaxes? I read that moderna even hidden the ingredients of the vaccine from its production employees.
FOIA could help there?
lol.
The bioweapon works exactly as intended. Vax is the weapon Humanity is The Virus they intend to kill, damage for life, sterilise, so useless eaters don't reproduce. They've told us the truth years in advance, but nobody is paying attention to "Bunch of nonsense and "conspiracy theories" 2012/1992 -https://lionessofjudah.substack.com/p/the-corona-end-game-addendum
I have no idea what this means so I started to search around and found this right away:
“Finally, we also show that segments of the C-terminal tail of pandonodin can be replaced with arbitrary sequences, allowing for the construction of pandonodin–protein fusions.”
https://pubs.acs.org/doi/10.1021/acschembio.9b00676
Not sure I understand anything any better though, but seems to follow what I am getting out of the last part of this post - which is the possible use of this thing for the introduction of something else. Maybe. Or maybe not.
How dare you ... don't you know that getting vaxxed and infected afterwards gives you ''super-immunity''? Forget the truth. Now you can even have ''super-truth'':
https://www.independent.co.uk/news/health/covid-vaccine-immunity-antibody-omicron-b1979528.html
Can I borrow "super-truth?" Well done.
No problem ... ''super-truth'' is for everyone - especially for those who cannot handle the simple ''truth'' spread by media and politicians ... ;-)
And regarding the truth (!) behind the smokescreen of "super-truth":
https://prometheusshrugged.substack.com/p/theswordofdomicron
"It’s time to reject the ‘science’ of the ‘scientists’ who’ve lied to us for nearly two years. That’s our Christmas gift to ourselves. Our only resolution for 2022 should be to demand - and be given - the truth."
Whatever it takes, let 2022 become the "Year of THE truth".
What are some possible immune responses if the unknown protein were to, I don’t know, somehow show up in the future?
Great question. I can look into that.
There are two immunogenic epitopes predicted by SVMTrip, and they map to, among other things, a key heart calcium channel proteins. It's a stretch (speculative analysis, Rev transcription, predicted epitopes) but certainly worth cataloging. Thank you for the prompt!
Might explain the many helices, could be a channel protein.
That's how science is supposed to work.
Wow, good eye. Don't children have high levels of reverse transcriptase? I though I read or heard somewhere recently that they do because their developing so rapidly. Please let me know if you're aware of anything on this. Thanks, Dawn.
Wow, you caught that! Awesome. Question. . . Don't Children have high levels of reverse transcriptase because they are developing so fast ? I thought I heard or read that somewhere recently. If so, could there be any implication with this discovery if their Pfizer vaxxed? If anyone know anything please let me know. I'm curious.
For control: no aa sequence on Wuhan wildtype reverse strand either. So only the Pfizer mRNA with that feature.
Wuhan transcript user at https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2?from=21563&to=25384&report=fasta
Right? Weird.
- No Prosite hits found.
- PsiPred finds mostly helical elements with quite some confidences (http://bioinf.cs.ucl.ac.uk/psipred/&uuid=8204b9c4-67c3-11ec-8d4b-00163e100d53)
Yes, check out Phyre2, it uses PsiPred among others. Rather ingenious. I use it in my bioinformatics class. http://www.sbg.bio.ic.ac.uk/phyre2/html/page.cgi?id=index
Subsequence blast hit against patent sequence ABW51755.1
Score Expect Method Identities Positives Gaps
63.5 bits(153) 7e-11 Composition-based stats. 28/52(54%) 42/52(80%) 0/52(0%)
Query 347 LDLADGAVELVGDQLLVLVQHILGHSDAVEPVGHLHSKGDLQSGACSKCPAA 398
L+L + V+LVGD LVL+++ILG+S+A+EP+ HLHSK L+S A +KCP++
Sbjct 2 LNLTNRLVKLVGDLFLVLIENILGNSNAIEPICHLHSKRYLKSSASTKCPSS 53
https://patents.google.com/patent/US7267942
Diagnostic assay for the human virus causing severe acute respiratory syndrome (SARS)
https://www.ncbi.nlm.nih.gov/protein/ABW51755.1?report=genbank&log$=protalign&blast_rank=1&RID=WNVX9UDF013
Are these hits just the PCR primers listed in the patent and deposited as translated amino acid sequences ?
Hmmm... hiding cross-protection in the antisense? Email me pls if it's safe to do so: info@ipak-edu.org
You should check out the substack and twitter of this genomics expert:
https://arkmedic.substack.com/p/how-to-blast-your-way-to-the-truth
https://twitter.com/JikkyKjj
I have been following you for years as the aunt of a vaccine injured child (now man). Just want to say how much I appreciate your tenacity in shining a light on the dangers forced upon us by pharma and our complicit government. I don’t pretend to understand all of this, but I keep trying and trust you to get to the core of the issue.
5 prime sequence upstream of ATG
>5-prime-sequence
tgctagctccagggtgtggctggcacgaaattgaccaaccctggggttagtatagcttagttaaactttcgtttattgctaaaggttaatcactgctgtttcccgtgggggtgtggctaggctaagcgttttgagctgcattgctgcgtgcttgggaggtgtctggaactagcagaggtggtgagtggggcaggtggaggtgggagcatacctgggacccgaggtcgggggagactcggggtacccaggacgggaaaggggcagctagcattgcgtgcatg