I wonder if there are more protein codes unknown to science to be discovered from their vaxes? I read that moderna even hidden the ingredients of the vaccine from its production employees.
The bioweapon works exactly as intended. Vax is the weapon Humanity is The Virus they intend to kill, damage for life, sterilise, so useless eaters don't reproduce. They've told us the truth years in advance, but nobody is paying attention to "Bunch of nonsense and "conspiracy theories" 2012/1992 -https://lionessofjudah.substack.com/p/the-corona-end-game-addendum
I have no idea what this means so I started to search around and found this right away:
“Finally, we also show that segments of the C-terminal tail of pandonodin can be replaced with arbitrary sequences, allowing for the construction of pandonodin–protein fusions.”
Not sure I understand anything any better though, but seems to follow what I am getting out of the last part of this post - which is the possible use of this thing for the introduction of something else. Maybe. Or maybe not.
How dare you ... don't you know that getting vaxxed and infected afterwards gives you ''super-immunity''? Forget the truth. Now you can even have ''super-truth'':
Wow, good eye. Don't children have high levels of reverse transcriptase? I though I read or heard somewhere recently that they do because their developing so rapidly. Please let me know if you're aware of anything on this. Thanks, Dawn.
Wow, you caught that! Awesome. Question. . . Don't Children have high levels of reverse transcriptase because they are developing so fast ? I thought I heard or read that somewhere recently. If so, could there be any implication with this discovery if their Pfizer vaxxed? If anyone know anything please let me know. I'm curious.
I have been following you for years as the aunt of a vaccine injured child (now man). Just want to say how much I appreciate your tenacity in shining a light on the dangers forced upon us by pharma and our complicit government. I don’t pretend to understand all of this, but I keep trying and trust you to get to the core of the issue.
Is there a cliff notes version that summarizes the import?
Like listening to the Sgt. Pepper album backwards!
I wonder if there are more protein codes unknown to science to be discovered from their vaxes? I read that moderna even hidden the ingredients of the vaccine from its production employees.
The bioweapon works exactly as intended. Vax is the weapon Humanity is The Virus they intend to kill, damage for life, sterilise, so useless eaters don't reproduce. They've told us the truth years in advance, but nobody is paying attention to "Bunch of nonsense and "conspiracy theories" 2012/1992 -https://lionessofjudah.substack.com/p/the-corona-end-game-addendum
I have no idea what this means so I started to search around and found this right away:
“Finally, we also show that segments of the C-terminal tail of pandonodin can be replaced with arbitrary sequences, allowing for the construction of pandonodin–protein fusions.”
https://pubs.acs.org/doi/10.1021/acschembio.9b00676
Not sure I understand anything any better though, but seems to follow what I am getting out of the last part of this post - which is the possible use of this thing for the introduction of something else. Maybe. Or maybe not.
How dare you ... don't you know that getting vaxxed and infected afterwards gives you ''super-immunity''? Forget the truth. Now you can even have ''super-truth'':
https://www.independent.co.uk/news/health/covid-vaccine-immunity-antibody-omicron-b1979528.html
What are some possible immune responses if the unknown protein were to, I don’t know, somehow show up in the future?
That's how science is supposed to work.
Wow, good eye. Don't children have high levels of reverse transcriptase? I though I read or heard somewhere recently that they do because their developing so rapidly. Please let me know if you're aware of anything on this. Thanks, Dawn.
Wow, you caught that! Awesome. Question. . . Don't Children have high levels of reverse transcriptase because they are developing so fast ? I thought I heard or read that somewhere recently. If so, could there be any implication with this discovery if their Pfizer vaxxed? If anyone know anything please let me know. I'm curious.
For control: no aa sequence on Wuhan wildtype reverse strand either. So only the Pfizer mRNA with that feature.
Wuhan transcript user at https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2?from=21563&to=25384&report=fasta
- No Prosite hits found.
- PsiPred finds mostly helical elements with quite some confidences (http://bioinf.cs.ucl.ac.uk/psipred/&uuid=8204b9c4-67c3-11ec-8d4b-00163e100d53)
Subsequence blast hit against patent sequence ABW51755.1
Score Expect Method Identities Positives Gaps
63.5 bits(153) 7e-11 Composition-based stats. 28/52(54%) 42/52(80%) 0/52(0%)
Query 347 LDLADGAVELVGDQLLVLVQHILGHSDAVEPVGHLHSKGDLQSGACSKCPAA 398
L+L + V+LVGD LVL+++ILG+S+A+EP+ HLHSK L+S A +KCP++
Sbjct 2 LNLTNRLVKLVGDLFLVLIENILGNSNAIEPICHLHSKRYLKSSASTKCPSS 53
https://patents.google.com/patent/US7267942
Diagnostic assay for the human virus causing severe acute respiratory syndrome (SARS)
https://www.ncbi.nlm.nih.gov/protein/ABW51755.1?report=genbank&log$=protalign&blast_rank=1&RID=WNVX9UDF013
You should check out the substack and twitter of this genomics expert:
https://arkmedic.substack.com/p/how-to-blast-your-way-to-the-truth
https://twitter.com/JikkyKjj
I have been following you for years as the aunt of a vaccine injured child (now man). Just want to say how much I appreciate your tenacity in shining a light on the dangers forced upon us by pharma and our complicit government. I don’t pretend to understand all of this, but I keep trying and trust you to get to the core of the issue.
5 prime sequence upstream of ATG
>5-prime-sequence
tgctagctccagggtgtggctggcacgaaattgaccaaccctggggttagtatagcttagttaaactttcgtttattgctaaaggttaatcactgctgtttcccgtgggggtgtggctaggctaagcgttttgagctgcattgctgcgtgcttgggaggtgtctggaactagcagaggtggtgagtggggcaggtggaggtgggagcatacctgggacccgaggtcgggggagactcggggtacccaggacgggaaaggggcagctagcattgcgtgcatg